PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00089813001
Common NameGSBRNA2T00089813001, LOC106362257
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 335aa    MW: 35892.6 Da    PI: 9.7145
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00089813001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1231e-3878136361
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          e alkcprCds ntkfCyynny+l+qPryfCkaCrryWt+GGalrnvPvGgg+rkn k+
  GSBRNA2T00089813001  78 EGALKCPRCDSINTKFCYYNNYNLTQPRYFCKACRRYWTRGGALRNVPVGGGCRKNSKK 136
                          5689****************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3063131IPR003851Zinc finger, Dof-type
PfamPF027015.9E-3380135IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.31181135IPR003851Zinc finger, Dof-type
PROSITE patternPS01361083119IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVFSSNWSQP TNSNHHQHQL HENGSLVSGH GLLSQQLPPC PPNPNPNNHY AAVASGLPAR  60
LGGSMAERAR QAKAPPPEGA LKCPRCDSIN TKFCYYNNYN LTQPRYFCKA CRRYWTRGGA  120
LRNVPVGGGC RKNSKKGKNG NSKSSSSSSK QSSSTVNDPS SNSGQLRTNY QFPFLPTLHN  180
LTQLEGIGLN LTAANGNNQG HQIGSSLMND LGFLHVGNGR NIAAPISGNI HDNNNNGASS  240
LMSHFNLFDP TTGLHAFQNG GNIVNNVGIS FSSTPMVDSR AYQAAPVKME EQPGLVNLSR  300
PVSGLTSPGN QTNQYLWNSS DFSGPSSNDH HQLL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.299110.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00089813001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842850.0FJ584285.1 Brassica rapa subsp. pekinensis OBF binding protein 2 Dof1.1-2 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013657566.10.0PREDICTED: dof zinc finger protein DOF1.1-like isoform X1
SwissprotQ8L9V61e-154DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLA0A078FRW30.0A0A078FRW3_BRANA; BnaA08g29080D protein
STRINGBra030696.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.31e-134Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]